![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4DL_7E6EA625C.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | CPP | ||||||||
| Protein Properties | Length: 92aa MW: 10678.3 Da PI: 8.5814 | ||||||||
| Description | CPP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCR | 45.1 | 2e-14 | 49 | 87 | 2 | 40 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
++kg +Ckks lkkYCeCf+a+ Cs++CkC dCkN e
Traes_4DL_7E6EA625C.1 49 HNKGWHCKKSGRLKKYCECFQANILCSKNCKCMDCKNFE 87
88999********************************65 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51634 | 16.96 | 1 | 88 | IPR005172 | CRC domain |
| SMART | SM01114 | 1.7E-14 | 48 | 89 | IPR033467 | Tesmin/TSO1-like CXC domain |
| Pfam | PF03638 | 2.8E-11 | 51 | 86 | IPR005172 | CRC domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
GSSSDTLYKE LWHACARPLI TVPRQGERIY HFPHVYMEQD ARAPSLPKHN KGWHCKKSGR 60 LKKYCECFQA NILCSKNCKC MDCKNFEGSE EL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5fd3_A | 3e-11 | 48 | 91 | 83 | 126 | Protein lin-54 homolog |
| 5fd3_B | 3e-11 | 48 | 91 | 83 | 126 | Protein lin-54 homolog |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HE996625 | 1e-36 | HE996625.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_60151. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020150694.1 | 3e-26 | protein tesmin/TSO1-like CXC 5 isoform X2 | ||||
| Swissprot | Q9SZD1 | 3e-21 | TCX5_ARATH; Protein tesmin/TSO1-like CXC 5 | ||||
| TrEMBL | A0A453J715 | 2e-63 | A0A453J715_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_4DL_7E6EA625C.1 | 3e-64 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G29000.1 | 1e-23 | Tesmin/TSO1-like CXC domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




