![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_4DS_F05E51AD8.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 76aa MW: 9070.24 Da PI: 7.8335 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 30.9 | 4.5e-10 | 5 | 38 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yps++++ LA+++gL+ +q+ +WF N+R ++
Traes_4DS_F05E51AD8.1 5 WPYPSESQKVALAESTGLDLKQINNWFINQRKRH 38
58*****************************885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 0.0047 | 1 | 45 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 11.337 | 1 | 41 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 5.56E-15 | 2 | 55 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 2 | 42 | IPR009057 | Homeodomain-like |
| Pfam | PF05920 | 2.3E-16 | 2 | 37 | IPR008422 | Homeobox KN domain |
| CDD | cd00086 | 3.33E-12 | 4 | 42 | No hit | No description |
| PROSITE pattern | PS00027 | 0 | 16 | 39 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MHYKWPYPSE SQKVALAEST GLDLKQINNW FINQRKRHWK PSDEMQFVMM DAYHPPNAAF 60 YMDGHFVNDS GLYRFG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May play a role in meristem formation and/or maintenance. Overexpression causes the hooded phenotype characterized by the appearance of an extra flower of inverse polarity on the lemma. Binds to the DNA sequence 5'-TGAC-3'. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF224500 | 1e-126 | AF224500.1 Triticum aestivum KNOTTED-1-like homeobox protein d (knox1d) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020147582.1 | 9e-52 | homeobox protein KNOX3 | ||||
| Swissprot | Q43484 | 2e-52 | KNOX3_HORVU; Homeobox protein KNOX3 | ||||
| TrEMBL | A0A453H9G5 | 9e-52 | A0A453H9G5_AEGTS; Uncharacterized protein | ||||
| STRING | EMT06308 | 3e-52 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP32297 | 2 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G08150.1 | 2e-37 | KNOTTED-like from Arabidopsis thaliana | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




