![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_047ABC9FC.1 | ||||||||
| Common Name | NFYA-A2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 130aa MW: 14578.7 Da PI: 10.8554 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.3 | 1.9e-31 | 65 | 121 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
d+p+YVNaKQy++Il+RR +Rak+e+e++l k+rkpylheSRh+hA+rR+Rg+gGrF
Traes_5AL_047ABC9FC.1 65 DAPIYVNAKQYEGILRRRRARAKVERENQL-VKGRKPYLHESRHRHAMRRARGTGGRF 121
68****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 6.1E-34 | 63 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.172 | 64 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.6E-28 | 67 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.0E-24 | 67 | 89 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.0E-24 | 98 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MEHSATIALQ SPLPEYNSRF EFGPGPSMMS SGYPSAEQCY GLLTTYAMKS TPGGRLLLPL 60 NATADAPIYV NAKQYEGILR RRRARAKVER ENQLVKGRKP YLHESRHRHA MRRARGTGGR 120 FLNTKKEGNG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-20 | 65 | 129 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 105 | 114 | RHRHAMRRAR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM078749 | 0.0 | KM078749.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-A2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020182505.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
| Refseq | XP_020182506.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
| Refseq | XP_020182507.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
| Swissprot | Q8LFU0 | 2e-30 | NFYAA_ARATH; Nuclear transcription factor Y subunit A-10 | ||||
| TrEMBL | A0A0A7LWR8 | 1e-88 | A0A0A7LWR8_WHEAT; CCAAT-binding transcription factor B | ||||
| STRING | Traes_5AL_047ABC9FC.1 | 3e-91 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2307 | 37 | 90 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G14020.1 | 3e-25 | nuclear factor Y, subunit A6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




