![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_09C375647.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 76aa MW: 9011.39 Da PI: 11.1104 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 30.1 | 1.1e-09 | 2 | 60 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
kr rr NRe+Ar +R++a +eL++kv+ L+++N+++kke e+ +e+ +l+ +
Traes_5AL_09C375647.1 2 KRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKETAMQEYLTLQETN 60
99**************************************************9998766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50217 | 9.599 | 1 | 63 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 4.6E-7 | 1 | 62 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 7.55E-8 | 2 | 57 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 8.8E-6 | 2 | 67 | No hit | No description |
| Pfam | PF00170 | 3.2E-8 | 2 | 60 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 6.68E-8 | 3 | 53 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
AKRLRRVLAN RESARQTILR RQAIRDELAR KVADLSSQNE SMKKEKETAM QEYLTLQETN 60 KQLKEQARHH LPLPLF |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020185471.1 | 9e-46 | G-box-binding factor 1-like | ||||
| TrEMBL | A0A446SWG7 | 5e-46 | A0A446SWG7_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5AL_09C375647.1 | 8e-47 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3165 | 34 | 75 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G19490.1 | 2e-17 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




