![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_637B13721.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 98aa MW: 11300.7 Da PI: 10.3521 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 50.1 | 7.2e-16 | 12 | 43 | 47 | 78 |
SSEEETTT--SS--S-STTTT-------S--- CS
SBP 47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78
+rfh l efDe+krsCr+rL++hn+rrrk+q
Traes_5AL_637B13721.2 12 ARFHLLAEFDEAKRSCRKRLDGHNRRRRKPQV 43
7****************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 13.298 | 1 | 41 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.1E-8 | 12 | 40 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.96E-13 | 12 | 46 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 2.2E-5 | 12 | 28 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MFVFLTINLC FARFHLLAEF DEAKRSCRKR LDGHNRRRRK PQVDSMTSGS FMTTQQGLYS 60 NAGTRFASFS APRPESSWSG IIKSEDSNPY YTTTHQIN |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 23 | 40 | KRSCRKRLDGHNRRRRKP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020178563.1 | 2e-53 | squamosa promoter-binding-like protein 18 | ||||
| Swissprot | Q0J0K1 | 1e-35 | SPL18_ORYSJ; Squamosa promoter-binding-like protein 18 | ||||
| TrEMBL | A0A446T808 | 3e-66 | A0A446T808_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5AL_637B13721.2 | 8e-69 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1755 | 37 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76580.1 | 8e-16 | SBP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




