![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_69590B897.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 80aa MW: 9400.88 Da PI: 11.6329 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 32.2 | 2.3e-10 | 5 | 45 | 13 | 53 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
NR +A+rsR RK+++i eLe+ v L+ e +aL ++ l
Traes_5AL_69590B897.1 5 NRQSAQRSRVRKLQYISELERSVTGLQMEVSALSPRVAFLD 45
****************************9999987776665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd14703 | 1.25E-16 | 2 | 48 | No hit | No description |
| SuperFamily | SSF57959 | 2.56E-10 | 3 | 51 | No hit | No description |
| SMART | SM00338 | 0.0037 | 3 | 57 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.4E-8 | 4 | 48 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.2E-12 | 5 | 51 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MILANRQSAQ RSRVRKLQYI SELERSVTGL QMEVSALSPR VAFLDHQRSL LTVQQPSQAK 60 NCRPCTRQDL QRWYRTFLPI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription regulator. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By white light. {ECO:0000269|PubMed:18065552}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003572005.1 | 2e-27 | basic leucine zipper 19 | ||||
| Swissprot | Q6K3R9 | 3e-25 | BZP19_ORYSJ; Basic leucine zipper 19 | ||||
| TrEMBL | A0A287R0Z5 | 2e-27 | A0A287R0Z5_HORVV; Uncharacterized protein | ||||
| STRING | Traes_5AL_69590B897.1 | 1e-51 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1322 | 38 | 125 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42380.2 | 3e-25 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




