![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_79E6A58E6.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 70aa MW: 8228.57 Da PI: 9.7493 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 39.2 | 1.5e-12 | 1 | 41 | 10 | 50 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
++kNRe+A rsR+RK+a++ eLe +v++L+ N++L +
Traes_5AL_79E6A58E6.1 1 MIKNRESAARSRARKQAYTMELEAEVQKLKDLNQELVRKQA 41
68*******************************98865443 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57959 | 8.44E-10 | 1 | 44 | No hit | No description |
| Pfam | PF00170 | 4.3E-10 | 1 | 42 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 8.9E-13 | 1 | 43 | No hit | No description |
| SMART | SM00338 | 7.3E-4 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 8.944 | 1 | 43 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 1.63E-15 | 1 | 48 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MIKNRESAAR SRARKQAYTM ELEAEVQKLK DLNQELVRKQ AEILEMQKRE VIDCLSSIPN 60 FPISMYRSTI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16463099}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB193553 | 1e-78 | AB193553.1 Triticum aestivum WABI5 mRNA for bZIP transcription factor, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020177661.1 | 2e-23 | bZIP transcription factor TRAB1-like isoform X2 | ||||
| Swissprot | Q9M7Q2 | 3e-19 | AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7 | ||||
| TrEMBL | A0A446T4K3 | 1e-42 | A0A446T4K3_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5AL_79E6A58E6.1 | 2e-43 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14602 | 10 | 20 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G19290.1 | 1e-21 | ABRE binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




