![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_9AE0ED26A.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 76aa MW: 9167.52 Da PI: 10.6905 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 56.5 | 5.8e-18 | 1 | 74 | 301 | 374 |
GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
eg+er+er et+++W+ r +aGF++vpl ++++k+a++ + k + + + v+e+++++++gWk+r + ++S W+
Traes_5AL_9AE0ED26A.1 1 EGTERVERPETYKQWQVRNLRAGFRQVPLLQETVKKARYKVIKSYHRDFFVDEDNKWMLQGWKGRVIGALSTWK 74
799*************************************99999899*************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 12.338 | 1 | 54 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 2.0E-15 | 1 | 74 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
EGTERVERPE TYKQWQVRNL RAGFRQVPLL QETVKKARYK VIKSYHRDFF VDEDNKWMLQ 60 GWKGRVIGAL STWKPS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK250792 | 1e-109 | AK250792.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf94i06, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020179545.1 | 1e-45 | scarecrow-like protein 9 | ||||
| Swissprot | O80933 | 6e-28 | SCL9_ARATH; Scarecrow-like protein 9 | ||||
| Swissprot | Q9LTI5 | 5e-28 | SCL11_ARATH; Scarecrow-like protein 11 | ||||
| TrEMBL | A0A3B6KT41 | 1e-46 | A0A3B6KT41_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446TLK6 | 1e-46 | A0A446TLK6_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5AL_9AE0ED26A.1 | 6e-50 | (Triticum aestivum) | ||||
| STRING | Traes_5BL_DF8EC4A24.2 | 2e-47 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP50526 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G59450.1 | 2e-30 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




