![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_D1807A4E0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 106aa MW: 11751.4 Da PI: 9.7096 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.5 | 4e-15 | 31 | 73 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g +T eEd l++ + + G++ W+ Ia++++ gRt++++k++w++
Traes_5AL_D1807A4E0.1 31 GQFTDEEDSLILSLYADIGSK-WSVIAAKLP-GRTDNDVKNHWNT 73
78*******************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 4.437 | 1 | 24 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-11 | 8 | 36 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 6.45E-24 | 10 | 79 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.516 | 25 | 79 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.8E-12 | 29 | 77 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-13 | 31 | 73 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.58E-10 | 33 | 75 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 37 | 76 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MTLPHKAGLN RCGKSCRLRW LNYLRPALRH GQFTDEEDSL ILSLYADIGS KWSVIAAKLP 60 GRTDNDVKNH WNTKLKKRHL LAMAPSPTPP TPATDSPSAS EADESS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3zqc_A | 5e-20 | 10 | 101 | 34 | 131 | MYB3 |
| 3zqc_D | 5e-20 | 10 | 101 | 34 | 131 | MYB3 |
| 3zqc_G | 5e-20 | 10 | 101 | 34 | 131 | MYB3 |
| 3zqc_J | 5e-20 | 10 | 101 | 34 | 131 | MYB3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020177100.1 | 4e-69 | transcription factor RAX2-like | ||||
| Swissprot | Q9SJL7 | 5e-43 | RAX2_ARATH; Transcription factor RAX2 | ||||
| TrEMBL | A0A3B6KUD1 | 3e-71 | A0A3B6KUD1_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_5AL_D1807A4E0.1 | 4e-73 | (Triticum aestivum) | ||||
| STRING | TRIUR3_05615-P1 | 2e-71 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP135 | 38 | 412 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G36890.1 | 4e-42 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




