![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5AL_E566BD64E.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 66aa MW: 7512.81 Da PI: 10.6286 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 77.1 | 2e-24 | 1 | 48 | 12 | 59 |
EE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 12 qKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
qK+vkg++ prsYY+Ct ++C+v+k++er+++dp++v +tY+g+Hnh+
Traes_5AL_E566BD64E.1 1 QKVVKGNPRPRSYYKCTAENCNVRKQIERASTDPRCVLTTYTGRHNHD 48
9**********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 2.6E-18 | 1 | 49 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.5E-21 | 1 | 50 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 26.314 | 1 | 50 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 8.1E-17 | 1 | 48 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.98E-19 | 1 | 50 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
QKVVKGNPRP RSYYKCTAEN CNVRKQIERA STDPRCVLTT YTGRHNHDPP GRGAGXXXXX 60 XXRLLL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-21 | 1 | 50 | 28 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-21 | 1 | 50 | 28 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK363803 | 8e-71 | AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020197516.1 | 4e-32 | probable WRKY transcription factor 58 | ||||
| Swissprot | Q9ZQ70 | 8e-20 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | A0A446TFJ3 | 4e-32 | A0A446TFJ3_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5AL_E566BD64E.1 | 2e-35 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2875 | 32 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 3e-22 | WRKY DNA-binding protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




