PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5BL_26B26165E.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

LBD

Protein Properties

Length: 76aa MW: 8448.43 Da PI: 7.2919

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5BL_26B26165E.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	65.8	1e-20	29	75	1	47
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+C ++C+lapyfpa++p+++anvh++FGasnv +ll+ Traes_5BL_26B26165E.1 29 RCAACKYLRRRCGHGCALAPYFPASRPRRYANVHRVFGASNVARLLQ 75 6******************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	16.549	28	76	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	8.4E-20	29	75	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MSTAGNEVEP EELQEEEEEE EGGGGNPRRC AACKYLRRRC GHGCALAPYF PASRPRRYAN 60 VHRVFGASNV ARLLQV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	5e-18	23	74	7	56	LOB family transfactor Ramosa2.1
5ly0_B	5e-18	23	74	7	56	LOB family transfactor Ramosa2.1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020179652.1	4e-31	LOB domain-containing protein 24-like
Swissprot	P59467	4e-19	LBD23_ARATH; LOB domain-containing protein 23
Swissprot	P59468	3e-19	LBD24_ARATH; LOB domain-containing protein 24
Swissprot	Q9SHE9	5e-19	LBD4_ARATH; LOB domain-containing protein 4
TrEMBL	A0A3B6LPM6	3e-46	A0A3B6LPM6_WHEAT; Uncharacterized protein
TrEMBL	A0A446UF16	3e-46	A0A446UF16_TRITD; Uncharacterized protein
STRING	Traes_5BL_26B26165E.1	5e-48	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP19720	7	8

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G26660.1	7e-21	LOB domain-containing protein 24

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]