![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5BL_8A463E577.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 93aa MW: 10148.3 Da PI: 7.3388 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 90.1 | 2.1e-28 | 18 | 76 | 1 | 60 |
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+++vrY eC++NhAas+Gg+avDGC+Ef+++ geegt alkC+ACgCHR+FH r +++e
Traes_5BL_8A463E577.2 18 CCGVRYGECRHNHAASTGGYAVDGCREFIAE-GEEGTLGALKCSACGCHRSFHHRVQVYE 76
5789**************************8.999********************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 2.0E-25 | 1 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 2.9E-27 | 21 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.5E-21 | 22 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 23.851 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MKRLVVLRRC EPIVRFSCCG VRYGECRHNH AASTGGYAVD GCREFIAEGE EGTLGALKCS 60 ACGCHRSFHH RVQVYEVAWD CESDTSSSSS SSG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK375715 | 1e-119 | AK375715.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3102E24. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020146636.1 | 2e-55 | mini zinc finger protein 3-like | ||||
| Swissprot | Q6ER22 | 4e-33 | MIF3_ORYSJ; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A3B6LL54 | 1e-60 | A0A3B6LL54_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446UB36 | 1e-60 | A0A446UB36_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5BL_8A463E577.2 | 2e-61 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 2e-26 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




