PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5DS_16243E52C.2

Common Name

AGL31, AGL9

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MIKC_MADS

Protein Properties

Length: 252aa MW: 28254.3 Da PI: 9.6656

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5DS_16243E52C.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.6	1e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Traes_5DS_16243E52C.2 9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP
2	K-box	96.5	4.1e-32	84	175	9	100
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek++ kiR++Knell ++i+++ k+e elq++ +Lr+ Traes_5DS_16243E52C.2 84 IEVNAQQYYQQEAAKLRHQIQMLQSTNKHLVGDSVGNLSLKELKQLESRLEKGIAKIRARKNELLSSEINYMVKREIELQSDSIDLRT 171 5667899********************************************************************************* PP K-box 97 klee 100 k++e Traes_5DS_16243E52C.2 172 KIAE 175 *986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.4E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.529	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.27E-32	2	74	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.24E-44	2	74	No hit	No description
PRINTS	PR00404	5.6E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.6E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.6E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.2E-23	86	173	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.878	89	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048283	Biological Process	indeterminate inflorescence morphogenesis
GO:0048316	Biological Process	seed development
GO:0048481	Biological Process	plant ovule development
GO:0080155	Biological Process	regulation of double fertilization forming a zygote and endosperm
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 252 aa Download sequence Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 SVKATIDRYK KAHACGSTSG VPLIEVNAQQ YYQQEAAKLR HQIQMLQSTN KHLVGDSVGN 120 LSLKELKQLE SRLEKGIAKI RARKNELLSS EINYMVKREI ELQSDSIDLR TKIAEEEQRL 180 QQVTIARPSV APELNPFTAL DMKCFFPANL FEAAVHAHAQ AQAQAQAQAS LQLNLGYQQL 240 APPGAGDVAH QF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
5f28_A	3e-19	1	69	1	69	MEF2C
5f28_B	3e-19	1	69	1	69	MEF2C
5f28_C	3e-19	1	69	1	69	MEF2C
5f28_D	3e-19	1	69	1	69	MEF2C
6c9l_A	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ512349	0.0	DQ512349.1 Triticum aestivum MADS-box transcription factor TaAGL31 (AGL31) mRNA, complete cds.
GenBank	DQ512364	0.0	DQ512364.1 Triticum aestivum MADS-box transcription factor TaAGL9 (AGL9) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020189538.1	0.0	MADS-box transcription factor 13-like
Swissprot	Q2QW53	1e-133	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A453K5J0	0.0	A0A453K5J0_AEGTS; Uncharacterized protein
TrEMBL	Q1G161	0.0	Q1G161_WHEAT; MADS-box transcription factor TaAGL31
STRING	Traes_5DS_16243E52C.2	0.0	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G42830.1	3e-83	MIKC_MADS family protein

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Zhao T, et al. Characterization and expression of 42 MADS-box genes in wheat (Triticum aestivum L.). Mol. Genet. Genomics, 2006. 276(4): p. 334-50 [PMID:16858583] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]