![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_5DS_446974FE9.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 111aa MW: 12898.9 Da PI: 10.4443 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 110.9 | 1.4e-34 | 21 | 98 | 51 | 129 |
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle
Traes_5DS_446974FE9.2 21 ASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR-RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 98
445789**********************************9999.999*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 36.359 | 1 | 111 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.4E-16 | 16 | 97 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.62E-34 | 22 | 102 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
LYLSLPCWYL YIIFHFLSVT ASVGGKEWYF YSLKDRKYAT GQRTNRATVS GYWKATGKDR 60 VVARRGALVG MRKTLVFYQG RAPKGRKTEW VMHEYRLEGA HEQASKVISC H |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 6e-30 | 17 | 97 | 62 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 6e-30 | 17 | 97 | 62 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC771286 | 1e-146 | KC771286.1 Triticum aestivum cultivar Suwon11 NAC transcription factor mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020198650.1 | 3e-58 | NAC domain-containing protein 21/22-like isoform X1 | ||||
| Refseq | XP_020198651.1 | 3e-58 | NAC domain-containing protein 21/22-like isoform X2 | ||||
| Swissprot | Q84TE6 | 4e-44 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
| TrEMBL | A0A088AX64 | 9e-62 | A0A088AX64_WHEAT; NAC transcription factor 6C | ||||
| TrEMBL | A0A446TVD9 | 9e-62 | A0A446TVD9_TRITD; Uncharacterized protein | ||||
| STRING | Traes_5DS_446974FE9.2 | 1e-77 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP27555 | 3 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56010.1 | 5e-47 | NAC domain containing protein 1 | ||||




