![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_6AS_6AAA7678C.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 84aa MW: 9334.64 Da PI: 7.8372 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 49.1 | 2.2e-15 | 5 | 35 | 132 | 162 |
YABBY 132 fikeeiqrikasnPdishreafsaaaknWah 162
++eeiqrika+ Pdi hreafs+aaknWa
Traes_6AS_6AAA7678C.1 5 ALREEIQRIKAAKPDIPHREAFSMAAKNWAK 35
689***************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 5.6E-14 | 6 | 36 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
SCCCALREEI QRIKAAKPDI PHREAFSMAA KNWAKCDPRC SSTVSASNSA PEPRIVVPGP 60 QLQERATEQV VESFDIFKQM ERSA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB470269 | 1e-131 | AB470269.1 Triticum aestivum TaDL mRNA for DL related protein, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020156144.1 | 5e-49 | protein DROOPING LEAF-like isoform X1 | ||||
| Refseq | XP_020156145.1 | 5e-49 | protein DROOPING LEAF-like isoform X2 | ||||
| Swissprot | Q76EJ0 | 2e-34 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
| TrEMBL | A0A452XAX6 | 2e-49 | A0A452XAX6_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_6AS_6AAA7678C.1 | 9e-55 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5951 | 36 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69180.1 | 6e-14 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




