![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_6DL_09329CC5D.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 74aa MW: 8590.8 Da PI: 10.684 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 89.1 | 4.8e-28 | 6 | 73 | 1 | 68 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikege 68
rW+++e+ aLi++r+em+ ++r+++lk+p Weevs+k++e g++rs+k+Ckek+en+ k+y+++keg+
Traes_6DL_09329CC5D.1 6 RWPREETVALIRIRSEMDGAFRNAALKAPVWEEVSRKLAELGYRRSAKKCKEKFENVDKYYRRTKEGR 73
8****************************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd12203 | 8.49E-25 | 5 | 70 | No hit | No description |
| Pfam | PF13837 | 7.0E-20 | 5 | 72 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-4 | 5 | 62 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 7.004 | 5 | 63 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
GGSGSRWPRE ETVALIRIRS EMDGAFRNAA LKAPVWEEVS RKLAELGYRR SAKKCKEKFE 60 NVDKYYRRTK EGRA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK375494 | 1e-111 | AK375494.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3095N08. | |||
| GenBank | AK376129 | 1e-111 | AK376129.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3115F22. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020184216.1 | 6e-40 | trihelix transcription factor GTL1-like | ||||
| Refseq | XP_020184217.1 | 6e-40 | trihelix transcription factor GTL1-like | ||||
| Swissprot | Q39117 | 1e-33 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
| TrEMBL | A0A287UDE4 | 9e-41 | A0A287UDE4_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287UDK1 | 2e-40 | A0A287UDK1_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287UDK8 | 5e-40 | A0A287UDK8_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287UDK9 | 4e-40 | A0A287UDK9_HORVV; Uncharacterized protein | ||||
| TrEMBL | F2EH67 | 4e-40 | F2EH67_HORVV; Predicted protein | ||||
| TrEMBL | F2EJ02 | 4e-40 | F2EJ02_HORVV; Predicted protein | ||||
| STRING | Traes_6DL_09329CC5D.1 | 2e-46 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP15223 | 12 | 18 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76890.2 | 5e-36 | Trihelix family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




