![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_6DL_1662431E2.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 56aa MW: 6764.6 Da PI: 11.2162 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 52.1 | 2.2e-16 | 11 | 54 | 51 | 94 |
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
+k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ + s
Traes_6DL_1662431E2.1 11 AKLSTNEWYFFSFRDRKYATGLRTNRATRSGYWKATGKDRVIRS 54
455779**********************************9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 20.893 | 1 | 56 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 8.37E-17 | 4 | 54 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.1E-5 | 17 | 50 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
SGWPWWYADV AKLSTNEWYF FSFRDRKYAT GLRTNRATRS GYWKATGKDR VIRSPR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK364002 | 3e-73 | AK364002.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2020L05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020173052.1 | 2e-28 | NAC domain-containing protein 76-like | ||||
| Swissprot | Q9S851 | 1e-18 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
| TrEMBL | A0A453PZQ1 | 5e-27 | A0A453PZQ1_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_6DL_1662431E2.1 | 5e-33 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28530.2 | 1e-26 | NAC domain containing protein 74 | ||||




