![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_6DL_410C5CD3B.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 141aa MW: 15649.7 Da PI: 9.2734 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 59.2 | 5.3e-19 | 61 | 94 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C++C+ kTp+WR gp g+ktLCnaCG++y++ +
Traes_6DL_410C5CD3B.1 61 CTHCQIDKTPQWRAGPLGPKTLCNACGVRYKSGR 94
*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.332 | 55 | 91 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 5.6E-16 | 55 | 105 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 6.8E-15 | 59 | 92 | IPR013088 | Zinc finger, NHR/GATA-type |
| SuperFamily | SSF57716 | 1.9E-15 | 59 | 118 | No hit | No description |
| CDD | cd00202 | 1.08E-14 | 60 | 117 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 61 | 86 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 9.8E-17 | 61 | 95 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MFSSTSSYSE EPECIAESNS QPKKKKKAKR PTPPVTSDAE GDADYEEGSG TALAPGEVRR 60 CTHCQIDKTP QWRAGPLGPK TLCNACGVRY KSGRLFPEYR PAASPTFVPA IHSNSHKKVV 120 EMRQKVEPKG DDLLQFIRRR D |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00130 | DAP | Transfer from AT1G08010 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353649 | 0.0 | AK353649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1001M24. | |||
| GenBank | AK356685 | 0.0 | AK356685.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1038B06. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020165199.1 | 1e-100 | GATA transcription factor 11-like | ||||
| Refseq | XP_020165203.1 | 1e-100 | GATA transcription factor 11-like | ||||
| Swissprot | Q6DBP8 | 2e-39 | GAT11_ARATH; GATA transcription factor 11 | ||||
| TrEMBL | A0A453PZI7 | 1e-100 | A0A453PZI7_AEGTS; Uncharacterized protein | ||||
| STRING | EMT09679 | 1e-99 | (Aegilops tauschii) | ||||
| STRING | Traes_6DL_410C5CD3B.1 | 1e-101 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5169 | 34 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 2e-40 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




