PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_6DL_7E6CE0C8E.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

DBB

Protein Properties

Length: 116aa MW: 12244.2 Da PI: 6.4688

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_6DL_7E6CE0C8E.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	22.9	1.8e-07	4	46	5	41
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+ ++ ++ C ++ lC+ C +e+H H++ p Traes_6DL_7E6CE0C8E.1 4 QCDSCGVAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46 7***999*******************6678888898877 PP
2	zf-B_box	29.1	2e-09	53	85	2	34
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 + ++C+ ++ek + +fC +++ l+C+dC + +H Traes_6DL_7E6CE0C8E.1 53 KLPRCDICQEKAAFIFCVEDRALFCRDCDEPIH 85 5789**************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50119	9.926	1	47	IPR000315	B-box-type zinc finger
CDD	cd00021	6.23E-5	3	47	No hit	No description
Pfam	PF00643	1.4E-5	4	47	IPR000315	B-box-type zinc finger
SMART	SM00336	1.5E-9	4	47	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	8.731	52	99	IPR000315	B-box-type zinc finger
SMART	SM00336	3.8E-14	52	99	IPR000315	B-box-type zinc finger
Pfam	PF00643	1.2E-7	53	95	IPR000315	B-box-type zinc finger
CDD	cd00021	4.03E-6	55	85	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005622	Cellular Component	intracellular
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MKIQCDSCGV AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAL GAKLPRCDIC 60 QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT GIRVGLGPVS ACAAGD

Functional Description ? help Back to Top
Source	Description
UniProt	Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269\|PubMed:12909688, ECO:0000269\|PubMed:17605755, ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:21685177, ECO:0000269\|PubMed:22410790, ECO:0000269\|PubMed:23624715}.
UniProt	Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). BBX25/STH and BBX24/STO function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX25/STH acts additively with BBX24/STO during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). {ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:23624715}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269\|PubMed:17605755}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT009289	0.0	BT009289.1 Triticum aestivum clone wlm0.pk0023.h3:fis, full insert mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020173021.1	2e-78	B-box zinc finger protein 25-like
Swissprot	Q96288	1e-54	BBX24_ARATH; B-box zinc finger protein 24
Swissprot	Q9SID1	8e-55	BBX25_ARATH; B-box zinc finger protein 25
TrEMBL	A0A3B6NQU0	3e-77	A0A3B6NQU0_WHEAT; Uncharacterized protein
STRING	MLOC_39632.1	6e-76	(Hordeum vulgare)
STRING	Traes_6DL_7E6CE0C8E.1	2e-78	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3202	33	68

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G06040.2	2e-46	DBB family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Gangappa SN,Holm M,Botto JF Molecular interactions of BBX24 and BBX25 with HYH, HY5 HOMOLOG, to modulate Arabidopsis seedling development. Plant Signal Behav, 2014. [PMID:23733077] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Imtiaz M, et al. Identification and functional characterization of the BBX24 promoter and gene from chrysanthemum in Arabidopsis. Plant Mol. Biol., 2015. 89(1-2): p. 1-19 [PMID:26253592] Zhang X,Lin R Light signaling differentially regulates the expression of group IV of the B-box zinc finger family. Plant Signal Behav, 2017. 12(9): p. e1365213 [PMID:28922622] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209]