![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_6DS_31C9B430A.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 63aa MW: 7435.34 Da PI: 5.0194 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 31 | 8.1e-10 | 25 | 63 | 1 | 39 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskeg 39
+fYn+YA e GFsvr+s+ + n+ i+ r+ vCs++g
Traes_6DS_31C9B430A.1 25 EFYNKYALEKGFSVRRSYVEWDGSNKYIILRKIVCSRQG 63
6************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 2.0E-7 | 25 | 63 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
ASDESMFEYL NVVSKMFDSE AEGYEFYNKY ALEKGFSVRR SYVEWDGSNK YIILRKIVCS 60 RQG |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 2e-96 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188780.1 | 9e-37 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| TrEMBL | A0A452XR33 | 2e-37 | A0A452XR33_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453DSV9 | 2e-37 | A0A453DSV9_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_6DS_31C9B430A.1 | 1e-38 | (Triticum aestivum) | ||||
| STRING | Traes_6DS_31C9B430A1.1 | 1e-38 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2449 | 9 | 76 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




