PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_03E14BABE.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family SBP
Protein Properties Length: 53aa    MW: 6073.89 Da    PI: 9.4705
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_03E14BABE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.96.4e-24653148
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                    SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                           +Cqve+C+adls ak+yhrrhkvCe h+ka+ v+++g++qrfCqqCsr
  Traes_7AL_03E14BABE.1  6 RCQVEDCKADLSGAKHYHRRHKVCEYHAKASLVAAAGKQQRFCQQCSR 53
                           6**********************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-24253IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.418453IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-23553IPR004333Transcription factor, SBP-box
PfamPF031101.7E-18753IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
HHQAPRCQVE DCKADLSGAK HYHRRHKVCE YHAKASLVAA AGKQQRFCQQ CSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-16753652squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478783e-76KF447878.1 Triticum aestivum squamosa promoter-binding-like protein 20 (SPL20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180502.11e-29squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-27SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-27SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A3B6RRC03e-29A0A3B6RRC0_WHEAT; Uncharacterized protein
TrEMBLA0A446XW763e-29A0A446XW76_TRITD; Uncharacterized protein
STRINGTraes_7AL_03E14BABE.12e-30(Triticum aestivum)
STRINGTRIUR3_10193-P15e-30(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.24e-24squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]