| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 49.6 | 8.9e-16 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+ Ed l+d v+++G g+W+++ r+ g+ R++k+c++rw ++l
Traes_7AL_0AD4A7A87.1 25 KGPWTQAEDRVLLDHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 72
79******************************************9996 PP
|
| 2 | Myb_DNA-binding | 48.2 | 2.4e-15 | 78 | 121 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g++++eE+ l+++++ + G++ W++I+ +++ gRt++++k++w++
Traes_7AL_0AD4A7A87.1 78 KGPFSPEEERLILRLHGLIGNK-WARISTHLP-GRTDNEVKNFWNT 121
79********************.*********.***********97 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB101 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
| UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
| UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. Required for anther development (PubMed:19454733, PubMed:20590996). Functions in parallel with UDT1 to regulate early anther development. Functions upstream of the transcription factor TDR and may positively regulate its transcription (PubMed:20590996). Required for pollen development. Probably required for controlling tapetal cell size and promoting tapetal programmed cell death (PCD) during anther development. Required for exine and Ubisch body formation in anthers. Interacts with the DNA specific motifs of giberrellin-up-regulated genes of anthers and regulates their expression. Positively regulates the expression of the laurate hydroxylase CYP703A3, known to be essential for the development of pollen exine and anther epicuticular layer (PubMed:19454733). Functions with MYBS1 to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of GAMYB and MYBS1, resulting in the expression of a large set of GA-inducible hydrolases, transporters and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:14688295, ECO:0000269|PubMed:19454733, ECO:0000269|PubMed:20590996, ECO:0000269|PubMed:22773748}. |
| Publications
? help Back to Top |
- Gocal GF, et al.
Long-day up-regulation of a GAMYB gene during Lolium temulentum inflorescence formation. Plant Physiol., 1999. 119(4): p. 1271-8 [PMID:10198085] - Ueguchi-Tanaka M, et al.
Rice dwarf mutant d1, which is defective in the alpha subunit of the heterotrimeric G protein, affects gibberellin signal transduction. Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11638-43 [PMID:11027362] - Sutoh K,Yamauchi D
Two cis-acting elements necessary and sufficient for gibberellin-upregulated proteinase expression in rice seeds. Plant J., 2003. 34(5): p. 635-45 [PMID:12787245] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Washio K
Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone. Plant Physiol., 2003. 133(2): p. 850-63 [PMID:14500792] - Eastmond PJ,Jones RL
Hormonal regulation of gluconeogenesis in cereal aleurone is strongly cultivar-dependent and gibberellin action involves SLENDER1 but not GAMYB. Plant J., 2005. 44(3): p. 483-93 [PMID:16236157] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Xie Z, et al.
Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells. Plant J., 2006. 46(2): p. 231-42 [PMID:16623886] - Tsuji H, et al.
GAMYB controls different sets of genes and is differentially regulated by microRNA in aleurone cells and anthers. Plant J., 2006. 47(3): p. 427-44 [PMID:16792694] - Wang Y,Wang YF,Zhang DB
[Identification of the rice (Oryza sativa L.) mutant msp1-4 and expression analysis of its UDT1 and GAMYB genes]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2006. 32(5): p. 527-34 [PMID:17075175] - Liu SM,Wang ZY,Cai XL
[Preliminary screening of target genes of rice transcription factor OsBP-73]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2007. 33(5): p. 456-62 [PMID:17960050] - Aya K, et al.
Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB. Plant Cell, 2009. 21(5): p. 1453-72 [PMID:19454733] - Hu L,Tan H,Liang W,Zhang D
The Post-meiotic Deficicent Anther1 (PDA1) gene is required for post-meiotic anther development in rice. J Genet Genomics, 2010. 37(1): p. 37-46 [PMID:20171576] - Liu Z,Bao W,Liang W,Yin J,Zhang D
Identification of gamyb-4 and analysis of the regulatory role of GAMYB in rice anther development. J Integr Plant Biol, 2010. 52(7): p. 670-8 [PMID:20590996] - Plackett AR,Thomas SG,Wilson ZA,Hedden P
Gibberellin control of stamen development: a fertile field. Trends Plant Sci., 2011. 16(10): p. 568-78 [PMID:21824801] - Aya K, et al.
The Gibberellin perception system evolved to regulate a pre-existing GAMYB-mediated system during land plant evolution. Nat Commun, 2011. 2: p. 544 [PMID:22109518] - Hong YF, et al.
Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748] - Wang Y, et al.
TamiR159 directed wheat TaGAMYB cleavage and its involvement in anther development and heat response. PLoS ONE, 2012. 7(11): p. e48445 [PMID:23133634] - Brenchley R, et al.
Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] - Zhang Y, et al.
GmGBP1, a homolog of human ski interacting protein in soybean, regulates flowering and stress tolerance in Arabidopsis. BMC Plant Biol., 2013. 13: p. 21 [PMID:23388059] - Zhang Y, et al.
A GAMYB homologue CsGAMYB1 regulates sex expression of cucumber via an ethylene-independent pathway. J. Exp. Bot., 2014. 65(12): p. 3201-13 [PMID:24790111] - Yano K, et al.
Comprehensive gene expression analysis of rice aleurone cells: probing the existence of an alternative gibberellin receptor. Plant Physiol., 2015. 167(2): p. 531-44 [PMID:25511432] - Sutoh K, et al.
An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds. Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59 [PMID:25559339] - Kwon CT,Kim SH,Kim D,Paek NC
The Rice Floral Repressor Early flowering1 Affects Spikelet Fertility By Modulating Gibberellin Signaling. Rice (N Y), 2015. 8(1): p. 58 [PMID:26202549] - Zheng Z, et al.
Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] - Suzuki A, et al.
Cloning and expression of five myb-related genes from rice seed. Gene, 1997. 198(1-2): p. 393-8 [PMID:9370307]
|