![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7AL_6931AA68B.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 73aa MW: 8075.39 Da PI: 10.4494 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 54.9 | 2.4e-17 | 2 | 44 | 18 | 60 |
TSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 18 liswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
+i w + +nsfvv d+ f++++Lp +Fkh+nf+SFvRQLn+Y
Traes_7AL_6931AA68B.1 2 VIGWGKGNNSFVVADPFVFSQTMLPAHFKHNNFSSFVRQLNTY 44
799***************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 2.1E-4 | 1 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene3D | G3DSA:1.10.10.10 | 1.9E-17 | 2 | 45 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.5E-14 | 2 | 44 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 1.6E-13 | 2 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.0E-5 | 24 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.0E-5 | 37 | 49 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
GVIGWGKGNN SFVVADPFVF SQTMLPAHFK HNNFSSFVRQ LNTYVSPLIP IYTSTPFVLS 60 ISVLLGRLRS CLS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF234653 | 5e-63 | KF234653.1 Triticum aestivum heat shock factor C2a (HsfC2a) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020193636.1 | 3e-26 | heat stress transcription factor C-2b-like | ||||
| Swissprot | Q0DBL6 | 9e-27 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
| TrEMBL | M0YV27 | 5e-31 | M0YV27_HORVV; Heat shock factor C2b | ||||
| STRING | Traes_7AL_6931AA68B.1 | 3e-46 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 4e-19 | heat shock transcription factor C1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




