![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7AL_DD8261917.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 103aa MW: 11754.7 Da PI: 10.3897 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 38.7 | 2.1e-12 | 1 | 46 | 10 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
+ +NRe+ArrsR+RK a++ Le v++L++e +L k+l e +++
Traes_7AL_DD8261917.1 1 MVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 46
579**********************************777776665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57959 | 2.04E-9 | 1 | 47 | No hit | No description |
| PROSITE profile | PS50217 | 9.22 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.2E-9 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 3.3E-10 | 2 | 47 | No hit | No description |
| SMART | SM00338 | 1.6E-4 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MVSNRESARR SRRRKHAQLT DLELQVEQLK SESATLFKQL TEANQQFTTA VTDNRILKSD 60 VETLRIKVKM AEDMVARGAV SCGLGQXXXX XXXXXXXDVT KPW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK361338 | 1e-104 | AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02. | |||
| GenBank | AK363257 | 1e-104 | AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020167700.1 | 2e-53 | basic leucine zipper 9-like isoform X1 | ||||
| Refseq | XP_020167701.1 | 2e-53 | basic leucine zipper 9-like isoform X2 | ||||
| Swissprot | Q6ETX0 | 9e-45 | RSBZ3_ORYSJ; bZIP transcription factor RISBZ3 | ||||
| TrEMBL | A0A453T1H5 | 2e-53 | A0A453T1H5_AEGTS; Uncharacterized protein | ||||
| TrEMBL | M7ZTE2 | 4e-53 | M7ZTE2_TRIUA; Regulatory protein opaque-2 | ||||
| STRING | Traes_7AL_DD8261917.1 | 3e-59 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2095 | 37 | 96 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G24800.1 | 4e-25 | basic leucine zipper 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




