PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_360247894.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 61aa    MW: 6774.74 Da    PI: 5.0047
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_360247894.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.52.3e-151322051
                           HHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF 20 ilKKAeELSvLCdaevaviifsstgklyeyss 51
                           ++KKA EL +LCda+ a+i+fsstg+ly+++s
  Traes_7AS_360247894.1  1 LMKKARELAILCDADLALIVFSSTGRLYDFAS 32
                           8*****************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF003192.6E-13130IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-4133IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.217134IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-17151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
LMKKARELAI LCDADLALIV FSSTGRLYDF ASSSGMEAIL ERYQEAKEEH RGVLNPTSEA  60
K
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5029037e-74AM502903.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM31C (WM31C gene).
GenBankDQ5123297e-74DQ512329.1 Triticum aestivum MADS-box transcription factor TaAGL6 (AGL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020153606.12e-35MADS-box transcription factor 25-like
SwissprotQ84NC59e-26MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLA0A3B6RDF71e-35A0A3B6RDF7_WHEAT; Uncharacterized protein
TrEMBLA0A446X2B01e-35A0A446X2B0_TRITD; Uncharacterized protein
STRINGTraes_7AS_360247894.13e-37(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.16e-14AGAMOUS-like 44
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  4. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]