![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7AS_376CD50EA.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 83aa MW: 9222.5 Da PI: 7.2579 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.3 | 8.3e-28 | 6 | 56 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+ri+n++nrqvtfskRr g++KKA EL +LCda+ a+i+fsstg+ly+++s
Traes_7AS_376CD50EA.1 6 ERIDNTTNRQVTFSKRRGGLMKKARELAILCDADLALIVFSSTGRLYDFAS 56
69***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd00265 | 1.01E-40 | 1 | 74 | No hit | No description |
| SMART | SM00432 | 4.5E-33 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.142 | 1 | 58 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.19E-30 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.0E-26 | 7 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-16 | 20 | 35 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-16 | 35 | 56 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
GKIAIERIDN TTNRQVTFSK RRGGLMKKAR ELAILCDADL ALIVFSSTGR LYDFASSSGM 60 EAILERYQEA KEEHCGVLNP TSE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-21 | 2 | 74 | 5 | 76 | MEF2C |
| 5f28_B | 2e-21 | 2 | 74 | 5 | 76 | MEF2C |
| 5f28_C | 2e-21 | 2 | 74 | 5 | 76 | MEF2C |
| 5f28_D | 2e-21 | 2 | 74 | 5 | 76 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502903 | 1e-111 | AM502903.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM31C (WM31C gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153469.1 | 4e-55 | MADS-box transcription factor 25-like | ||||
| Swissprot | Q84NC5 | 8e-44 | MAD25_ORYSJ; MADS-box transcription factor 25 | ||||
| TrEMBL | A0A446X283 | 2e-54 | A0A446X283_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446Y1U5 | 3e-54 | A0A446Y1U5_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446Y2B9 | 2e-54 | A0A446Y2B9_TRITD; Uncharacterized protein | ||||
| STRING | Traes_7DS_D9008CC09.1 | 4e-55 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 2e-27 | AGAMOUS-like 44 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




