![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7AS_3B8CB5283.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 64aa MW: 7025.14 Da PI: 9.4917 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.3 | 7.3e-18 | 21 | 64 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+g+WT+eEd+llvd++++ G g+W++ ++ g++R++k+c++rw
Traes_7AS_3B8CB5283.1 21 KGPWTPEEDKLLVDYIQEKGHGSWRRLPKLAGLNRCGKSCRLRW 64
79****************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.26 | 16 | 64 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.01E-14 | 18 | 64 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 7.4E-19 | 19 | 64 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.6E-6 | 20 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.1E-16 | 21 | 64 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.37E-10 | 23 | 64 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
LVGGGAMGRS PCCDGEAGVK KGPWTPEEDK LLVDYIQEKG HGSWRRLPKL AGLNRCGKSC 60 RLRW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF057260 | 7e-62 | EF057260.1 Panicum virgatum microsatellite PVSSR146 and microsatellite PVSSR147 sequences. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020179049.1 | 3e-35 | transcription factor MYB39-like | ||||
| Swissprot | Q9S9Z2 | 2e-31 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A453QDI4 | 2e-34 | A0A453QDI4_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453QDI6 | 2e-34 | A0A453QDI6_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_7AS_3B8CB5283.1 | 3e-39 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 7e-34 | myb domain protein 93 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




