PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7AS_45F0BB787.2

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

Whirly

Protein Properties

Length: 115aa MW: 13222 Da PI: 6.5233

Description

Whirly family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7AS_45F0BB787.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Whirly	102.3	4.3e-32	2	78	63	139
Whirly 63 aelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 ++l+ l+ +sceffhdp+++ s+eGkvrk+lkveP pdG G f+nlsv+n l++++e++++P++k+e+av+ s ++ Traes_7AS_45F0BB787.2 2 GTLLTLGLTDSCEFFHDPFKGRSDEGKVRKVLKVEPTPDGNGRFFNLSVQNRLLNVDENIYIPITKGEYAVIVSTFN 78 8999********************************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08536	1.2E-27	1	75	IPR013742	Plant transcription factor
Gene3D	G3DSA:2.30.31.10	3.8E-40	1	100	IPR009044	ssDNA-binding transcriptional regulator
SuperFamily	SSF54447	2.35E-42	1	115	IPR009044	ssDNA-binding transcriptional regulator

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MGTLLTLGLT DSCEFFHDPF KGRSDEGKVR KVLKVEPTPD GNGRFFNLSV QNRLLNVDEN 60 IYIPITKGEY AVIVSTFNYI IPHIMGWSTF TNSIKPEESQ PYNRPQSSPE LEWRR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1l3a_A	5e-53	1	113	104	218	p24: plant transcriptional regulator PBF-2
1l3a_B	5e-53	1	113	104	218	p24: plant transcriptional regulator PBF-2
1l3a_C	5e-53	1	113	104	218	p24: plant transcriptional regulator PBF-2
1l3a_D	5e-53	1	113	104	218	p24: plant transcriptional regulator PBF-2
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269\|PubMed:18676978, ECO:0000269\|PubMed:19666500}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353795	1e-160	AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22.
GenBank	AK365452	1e-160	AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020186783.1	8e-81	single-stranded DNA-binding protein WHY1, chloroplastic-like
Swissprot	B2LXS7	2e-71	WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBL	A0A287VMG3	1e-79	A0A287VMG3_HORVV; Uncharacterized protein
TrEMBL	F2CQ93	1e-79	F2CQ93_HORVV; Predicted protein
STRING	Traes_7DS_B1FD1C84F.2	4e-81	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3012	38	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02740.2	6e-57	ssDNA-binding transcriptional regulator

Publications ? help Back to Top
Soderlund C, et al. Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs. PLoS Genet., 2009. 5(11): p. e1000740 [PMID:19936069] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]