PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7BL_07CC0B6EF.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 169aa MW: 18777.4 Da PI: 9.9248

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7BL_07CC0B6EF.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.1	4.4e-14	64	116	3	55
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +r rr+ +NRe+ArrsR+RK a++ Le v++L++e +L k+l e +++ Traes_7BL_07CC0B6EF.1 64 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 116 56899***************************************777776665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.5E-13	62	126	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.749	64	116	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.3E-11	65	116	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.2E-12	66	117	No hit	No description
SuperFamily	SSF57959	5.7E-11	66	118	No hit	No description
PROSITE pattern	PS00036	0	69	84	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
FRVGKEIDRD TPGFCLTCCI VLVAASPRET ISGNQALETE SDSDSESLVE IGGGRCKRSG 60 KSSDTRRIRR MVSNRESARR SRRRKHAQLT DLELQVEQLK SESATLFKQL TEANQQFTTA 120 VTDNRILKSD VETLRIKVKM AEDMVARGAV SCGLGQQLGL APFLNSRKM

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269\|PubMed:11133985, ECO:0000269\|PubMed:7919992}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK361338	1e-180	AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02.
GenBank	AK363257	1e-180	AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020167700.1	8e-99	basic leucine zipper 9-like isoform X1
Refseq	XP_020167701.1	8e-99	basic leucine zipper 9-like isoform X2
Swissprot	Q6ETX0	1e-60	RSBZ3_ORYSJ; bZIP transcription factor RISBZ3
TrEMBL	A0A3B6TRJ2	2e-97	A0A3B6TRJ2_WHEAT; Uncharacterized protein
TrEMBL	M7ZTE2	4e-98	M7ZTE2_TRIUA; Regulatory protein opaque-2
TrEMBL	M8AMI0	2e-97	M8AMI0_AEGTA; Regulatory protein opaque-2
STRING	Traes_7BL_07CC0B6EF.1	1e-119	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2095	37	96

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G24800.1	9e-28	basic leucine zipper 9

Publications ? help Back to Top
Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif. J. Biol. Chem., 2001. 276(17): p. 14139-52 [PMID:11133985] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Izawa T,Foster R,Nakajima M,Shimamoto K,Chua NH The rice bZIP transcriptional activator RITA-1 is highly expressed during seed development. Plant Cell, 1994. 6(9): p. 1277-87 [PMID:7919992]