![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7BL_7E32A8329.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 54aa MW: 6490.53 Da PI: 9.8085 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 30.1 | 8.5e-10 | 8 | 40 | 22 | 54 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
ryp+ +e+ LA++ gL+ +qV++WF N R +
Traes_7BL_7E32A8329.1 8 ARYPKDHEKDMLAARSGLSRSQVSNWFINARVR 40
59*****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.398 | 1 | 44 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 0.003 | 3 | 48 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 6.42E-13 | 8 | 51 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.39E-8 | 9 | 45 | No hit | No description |
| Pfam | PF05920 | 2.1E-13 | 10 | 40 | IPR008422 | Homeobox KN domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-17 | 10 | 50 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
TDLLIPRARY PKDHEKDMLA ARSGLSRSQV SNWFINARVR LWKPMIEEMY EELK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor which may be involved in the signal transduction pathway downstream of the COP1 gene. Controls floral competency as a specific activator of FLC expression. Is responsive of the nuclear import of SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:17908157}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light. In etiolated seedlings, maximally expressed after 3 days of illumination. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB546644 | 2e-67 | AB546644.1 Triticum aestivum WBLH2-1 mRNA for BEL1-type homeodomain protein, complete cds. | |||
| GenBank | AB546645 | 2e-67 | AB546645.1 Triticum aestivum WBLH2-2 mRNA for BEL1-type homeodomain protein, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020196798.1 | 2e-24 | BEL1-like homeodomain protein 2 | ||||
| Swissprot | P48731 | 8e-20 | ATH1_ARATH; Homeobox protein ATH1 | ||||
| TrEMBL | A0A287X7Y5 | 9e-27 | A0A287X7Y5_HORVV; Uncharacterized protein | ||||
| STRING | Traes_7BL_7E32A8329.1 | 9e-33 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP7715 | 31 | 46 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G32980.1 | 3e-22 | homeobox gene 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




