PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7BL_F09405E3E.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 131aa MW: 15214.6 Da PI: 10.3082

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7BL_F09405E3E.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	127.3	1.2e-39	2	94	35	128
NAM 35 kevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWv 122 +vd++k+ePwdLp+ + + kewyf+s rd+kyatg+r+nrat+sgyWkatgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wv Traes_7BL_F09405E3E.1 2 VDVDLNKIEPWDLPEIACIGGKEWYFYSLRDRKYATGQRTNRATESGYWKATGKDRSISR-KGLLVGMRKTLVFYQGRAPKGKKTEWV 88 689*********7666789*********************************99.999******************** PP NAM 123 mheyrl 128 mhe+r Traes_7BL_F09405E3E.1 89 MHEFRK 94 **96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	45.055	1	117	IPR003441	NAC domain
SuperFamily	SSF101941	7.72E-47	2	117	IPR003441	NAC domain
Pfam	PF02365	1.2E-15	15	93	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
MVDVDLNKIE PWDLPEIACI GGKEWYFYSL RDRKYATGQR TNRATESGYW KATGKDRSIS 60 RKGLLVGMRK TLVFYQGRAP KGKKTEWVMH EFRKEGQGDL MKLPLKEDWV LCRVFYKTRA 120 TVAKPPTGSS Y

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-38	1	124	49	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-38	1	124	49	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-38	1	124	49	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-38	1	124	49	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-38	1	124	52	174	NAC domain-containing protein 19
3swm_B	1e-38	1	124	52	174	NAC domain-containing protein 19
3swm_C	1e-38	1	124	52	174	NAC domain-containing protein 19
3swm_D	1e-38	1	124	52	174	NAC domain-containing protein 19
3swp_A	1e-38	1	124	52	174	NAC domain-containing protein 19
3swp_B	1e-38	1	124	52	174	NAC domain-containing protein 19
3swp_C	1e-38	1	124	52	174	NAC domain-containing protein 19
3swp_D	1e-38	1	124	52	174	NAC domain-containing protein 19
4dul_A	1e-38	1	124	49	171	NAC domain-containing protein 19
4dul_B	1e-38	1	124	49	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK356223	1e-170	AK356223.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1031L15.
GenBank	HM027572	1e-170	HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020174529.1	6e-92	NAC domain-containing protein 21/22-like
Swissprot	Q84TE6	2e-60	NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBL	A0A3B6RLH7	2e-92	A0A3B6RLH7_WHEAT; Uncharacterized protein
STRING	Traes_7AL_BE3253C8F.1	3e-93	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1012	37	138

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56010.2	7e-63	NAC domain containing protein 1

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]