| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 51.6 | 1.8e-16 | 2 | 47 | 226 | 272 |
GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
+vL +v+ ++P++v+vveqe +hns++Fl+rf+e +yys++fds+
Traes_7BS_54E859139.1 2 KVLGTVRAVRPRIVTVVEQEGNHNSGTFLDRFTEH-YYYSTMFDSWT 47
69*******************************97.699******94 PP
|
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | FM878945 | 3e-58 | FM878945.1 Triticum aestivum Rht-Ble gene for mutated DELLA protein. |
| GenBank | FR668586 | 3e-58 | FR668586.2 Triticum aestivum rht-B1 gene, allele a. |
| GenBank | FR668587 | 3e-58 | FR668587.1 Triticum aestivum rht-B1 gene, allele h. |
| GenBank | FR668588 | 3e-58 | FR668588.1 Triticum aestivum rht-B1 gene, allele i. |
| GenBank | FR668589 | 3e-58 | FR668589.1 Triticum aestivum rht-B1 gene, allele j. |
| GenBank | FR719732 | 3e-58 | FR719732.1 Triticum aestivum rht-B1a gene for DELLA protein. |
| GenBank | GQ451335 | 3e-58 | GQ451335.2 Triticum aestivum cultivar Xiaoyan 54 truncated DELLA protein RHT-B1b gene, complete cds. |
| GenBank | JF930278 | 3e-58 | JF930278.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1a allele, complete cds. |
| GenBank | JF930279 | 3e-58 | JF930279.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1c allele, complete cds. |
| GenBank | JF930280 | 3e-58 | JF930280.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1e allele, complete cds. |
| GenBank | JN857970 | 3e-58 | JN857970.1 Triticum aestivum mutant DELLA protein gene, complete cds. |
| GenBank | JN857971 | 3e-58 | JN857971.1 Triticum aestivum mutant DELLA protein mRNA, complete cds. |
| GenBank | KC614614 | 3e-58 | KC614614.1 Triticum aestivum cultivar Robigus bio-material NIAB EW66-3 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614615 | 3e-58 | KC614615.1 Triticum aestivum cultivar Siete Cerros bio-material JIC:614 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614616 | 3e-58 | KC614616.1 Triticum aestivum cultivar Soissons bio-material NIAB EW9 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC614617 | 3e-58 | KC614617.1 Triticum aestivum cultivar W7984 bio-material INRA:13812 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds. |
| GenBank | KC767925 | 3e-58 | KC767925.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1a allele, complete cds. |
| GenBank | KC767926 | 3e-58 | KC767926.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1c allele, complete cds. |
| GenBank | KF282628 | 3e-58 | KF282628.1 Triticum durum cultivar Langdon clone BAC 315P18 chromosome 4B DELLA protein (Rht-B) gene, complete cds, complete sequence. |
| GenBank | KT013263 | 3e-58 | KT013263.1 Triticum aestivum truncated DELLA protein RHT-B1 (Rht-B1) gene, Rht-B1-p allele, complete cds. |