PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7BS_7B68879A9.2

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 106aa MW: 12158.1 Da PI: 10.5505

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7BS_7B68879A9.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	35.3	2.6e-11	15	66	5	56
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 kr +r NR +A rs +RK +i+eLe kv++L++e ++L +l +l+ + Traes_7BS_7B68879A9.2 15 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDS 66 899******************************************9998766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.4E-18	11	75	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	2.1E-10	12	64	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.726	13	76	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.0E-13	15	65	No hit	No description
SuperFamily	SSF57959	8.44E-13	15	65	No hit	No description
CDD	cd14703	1.08E-18	16	65	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MANERLAEIA LTDPKRVKRI LANRQSAARS KERKMRYIQE LEHKVQVLQT EATTLSAQLT 60 MLQRDSGGLA TQNNELKIRL QAMEQQAQLR DGMLLMVPFF ISFGEN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:14704272}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB199586	1e-144	AB199586.1 Hordeum vulgare HvIRO1 mRNA for basic leucine zipper transcription factor, partial cds, cultivar: Ehimehadaka no.1.
GenBank	AK374525	1e-144	AK374525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3068B13.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003574872.1	6e-55	transcription factor RF2a
Swissprot	Q6S4P4	6e-41	RF2B_ORYSJ; Transcription factor RF2b
TrEMBL	A0A446YDX4	2e-70	A0A446YDX4_TRITD; Uncharacterized protein
STRING	Traes_7BS_7B68879A9.2	4e-71	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP6247	36	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	5e-48	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]