![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7BS_F4CFCDF52.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 82aa MW: 9404.98 Da PI: 10.5893 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.4 | 4.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri+nk rqvtf+kRrng+lKKA+ELSvLCda va+iifs++g+l+e+s+
Traes_7BS_F4CFCDF52.1 9 KRIDNKVSRQVTFAKRRNGLLKKAYELSVLCDAVVALIIFSTRGRLFEFST 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.805 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.9E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.38E-35 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 2.49E-28 | 2 | 69 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.0E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MGRGKVELKR IDNKVSRQVT FAKRRNGLLK KAYELSVLCD AVVALIIFST RGRLFEFSTS 60 SYMWCSCSRS TNQSYKCEIR AT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 7e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:16217607, ECO:0000269|PubMed:9085264, ECO:0000269|Ref.8}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502886 | 3e-86 | AM502886.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM20 (WM20 gene). | |||
| GenBank | DQ512359 | 3e-86 | DQ512359.1 Triticum aestivum MADS-box transcription factor TaAGL8 (AGL8) mRNA, complete cds. | |||
| GenBank | DQ512362 | 3e-86 | DQ512362.1 Triticum aestivum MADS-box transcription factor TaAGL5 (AGL5) mRNA, complete cds. | |||
| GenBank | DQ534491 | 3e-86 | DQ534491.1 Triticum aestivum MADS3 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001288306.1 | 8e-36 | MADS-box transcription factor 5-like | ||||
| Refseq | XP_020184037.1 | 8e-36 | MADS-box transcription factor 5-like | ||||
| Swissprot | A2Y9P0 | 6e-36 | MADS5_ORYSI; MADS-box transcription factor 5 | ||||
| Swissprot | Q0DEB8 | 6e-36 | MADS5_ORYSJ; MADS-box transcription factor 5 | ||||
| TrEMBL | A0A3B6SDB3 | 3e-37 | A0A3B6SDB3_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446Y2P6 | 3e-37 | A0A446Y2P6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446Y2V9 | 9e-37 | A0A446Y2V9_TRITD; Uncharacterized protein | ||||
| STRING | Traes_7BS_F4CFCDF52.1 | 2e-53 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G24260.3 | 2e-33 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




