![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7DS_7B303CBAF.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | CAMTA | ||||||||
| Protein Properties | Length: 54aa MW: 6471.37 Da PI: 11.4274 | ||||||||
| Description | CAMTA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CG-1 | 54.3 | 2.6e-17 | 1 | 35 | 43 | 77 |
CG-1 43 nrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77
nr++ r+frkDGy w++kkdg+tv E+he+LK +
Traes_7DS_7B303CBAF.1 1 NRRVNRFFRKDGYAWRRKKDGRTVGEAHERLKSCQ 35
89******************************655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03859 | 8.0E-12 | 1 | 38 | IPR005559 | CG-1 DNA-binding domain |
| PROSITE profile | PS51437 | 24.385 | 1 | 54 | IPR005559 | CG-1 DNA-binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
NRRVNRFFRK DGYAWRRKKD GRTVGEAHER LKSCQQERVP PVRTSRTGCA CPFY |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024311654.1 | 6e-16 | calmodulin-binding transcription activator 4 isoform X4 | ||||
| STRING | Traes_2AS_AE392E835.1 | 5e-33 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G67310.1 | 2e-13 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




