![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7DS_7F8C88C92.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 75aa MW: 8356.86 Da PI: 10.8579 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 80.9 | 8.3e-26 | 10 | 58 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rien s+r vtfskRr+g+lKKA EL +LCd+ev vi+fs tg+lyey++
Traes_7DS_7F8C88C92.2 10 RIENMSRRPVTFSKRRHGLLKKARELAILCDVEVGVIVFS-TGHLYEYAN 58
8**************************************8.7******85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 25.048 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-31 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.06E-23 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-19 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.7E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-19 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-19 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MVRGKIVIRR IENMSRRPVT FSKRRHGLLK KARELAILCD VEVGVIVFST GHLYEYANST 60 AATSMGTTMP STCSL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153605.1 | 1e-45 | MADS-box transcription factor 25-like | ||||
| Swissprot | Q9SI38 | 5e-22 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
| TrEMBL | M8CY23 | 9e-45 | M8CY23_AEGTA; MADS-box transcription factor 25 | ||||
| STRING | Traes_7DS_7F8C88C92.2 | 2e-48 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 2e-24 | AGAMOUS-like 44 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




