PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_A07050CB8.1
Common NameNFYB-A1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 81aa    MW: 9260.53 Da    PI: 6.2402
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_A07050CB8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB123.21.1e-381781794
                  NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                           m+++lPa+akis+dake +qecvsefisfvt+ea+++c+ ++rkt+n++d++wal  lGf+dyv pl+v+l++ r+ e
  Traes_7DS_A07050CB8.1  1 MRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCRMQHRKTVNAEDIVWALNRLGFDDYVVPLSVFLHRMRDPE 78
                           89*************************************************************************977 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.6E-19155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.74E-27178IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.3E-34178IPR009072Histone-fold
PRINTSPR006151.2E-141937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-143856No hitNo description
PRINTSPR006151.2E-145775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MRRALPAHAK ISDDAKEAIQ ECVSEFISFV TGEANERCRM QHRKTVNAED IVWALNRLGF  60
DDYVVPLSVF LHRMRDPEAG T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-391762297NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090291e-126BT009029.1 Triticum aestivum clone wdk3c.pk023.h15:fis, full insert mRNA sequence.
GenBankKM0787341e-126KM078734.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020178161.13e-55nuclear transcription factor Y subunit B-8-like
SwissprotQ84W663e-38NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0A7LWQ86e-54A0A0A7LWQ8_WHEAT; CCAAT-binding transcription factor A
TrEMBLA0A3B6TPF27e-54A0A3B6TPF2_WHEAT; Uncharacterized protein
TrEMBLA0A446Y9J56e-54A0A446Y9J5_TRITD; Uncharacterized protein
TrEMBLA0A446Y9K73e-54A0A446Y9K7_TRITD; Uncharacterized protein
TrEMBLA0A446Y9M82e-54A0A446Y9M8_TRITD; Uncharacterized protein
STRINGTraes_7DS_A07050CB8.16e-55(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-41nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  2. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  3. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]
  4. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  5. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  6. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  7. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]