PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7DS_B1FD1C84F.2

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

Whirly

Protein Properties

Length: 130aa MW: 14899 Da PI: 6.526

Description

Whirly family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7DS_B1FD1C84F.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Whirly	114.1	9.9e-36	7	93	53	139
Whirly 53 qsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 +f+ls+ e+++l+ l+ +sceffhdp+++ s+eGkvrk+lkveP pdG G f+nlsv+n l++++e++++P++k+e+av+ s ++ Traes_7DS_B1FD1C84F.2 7 RVFSLSVWEMGTLLTLGLTDSCEFFHDPFKGRSDEGKVRKVLKVEPTPDGNGRFFNLSVQNRLLNVDENIYIPITKGEYAVIVSTFN 93 58********************************************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08536	1.7E-32	7	90	IPR013742	Plant transcription factor
SuperFamily	SSF54447	1.96E-46	8	130	IPR009044	ssDNA-binding transcriptional regulator
Gene3D	G3DSA:2.30.31.10	1.9E-45	8	115	IPR009044	ssDNA-binding transcriptional regulator

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MIGLASRVFS LSVWEMGTLL TLGLTDSCEF FHDPFKGRSD EGKVRKVLKV EPTPDGNGRF 60 FNLSVQNRLL NVDENIYIPI TKGEYAVIVS TFNYIIPHIM GWSTFTNSIK PEESQPYNRP 120 QSSPELEWRR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1l3a_A	3e-57	7	128	95	218	p24: plant transcriptional regulator PBF-2
1l3a_B	3e-57	7	128	95	218	p24: plant transcriptional regulator PBF-2
1l3a_C	3e-57	7	128	95	218	p24: plant transcriptional regulator PBF-2
1l3a_D	3e-57	7	128	95	218	p24: plant transcriptional regulator PBF-2
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269\|PubMed:18676978, ECO:0000269\|PubMed:19666500}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353795	1e-176	AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22.
GenBank	AK365452	1e-176	AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020186783.1	2e-87	single-stranded DNA-binding protein WHY1, chloroplastic-like
Swissprot	B2LXS7	8e-78	WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBL	F2CQ93	3e-86	F2CQ93_HORVV; Predicted protein
STRING	Traes_7DS_B1FD1C84F.2	2e-92	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3012	38	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02740.2	2e-61	ssDNA-binding transcriptional regulator

Publications ? help Back to Top
Soderlund C, et al. Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs. PLoS Genet., 2009. 5(11): p. e1000740 [PMID:19936069] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]