![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_7DS_BA2B07F73.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 68aa MW: 8034.22 Da PI: 9.1282 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 42.1 | 2.9e-13 | 20 | 65 | 44 | 90 |
FAR1 44 ekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
+ kk++ +r++ + +tgCkak+ vk dg+wev+ +++eHnH+l+
Traes_7DS_BA2B07F73.1 20 KGKKRSMKRKRDKIVQTGCKAKMIVKVI-DGRWEVIYFVSEHNHPLV 65
3333678899999***************.****************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 3.3E-11 | 18 | 65 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
EQEKNDNEDE AIVFLDDDSK GKKRSMKRKR DKIVQTGCKA KMIVKVIDGR WEVIYFVSEH 60 NHPLVYKP |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 4e-91 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188487.1 | 1e-14 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| TrEMBL | A0A453A2Q1 | 3e-30 | A0A453A2Q1_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_7DS_BA2B07F73.1 | 3e-43 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP9528 | 8 | 43 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




