![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang0032ss00820.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 86aa MW: 9585.12 Da PI: 9.6348 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 46.5 | 1.2e-14 | 3 | 47 | 65 | 110 |
NAM 65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfyk 110
d+ky +g+r+nra+++gyWk+tgkd++v + +++++g+kktL ++
Vang0032ss00820.4 3 DRKYGNGSRTNRAIEKGYWKTTGKDRPVAH-DDRTMGMKKTLLYHA 47
79****************************.999**********94 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 13.385 | 1 | 85 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 8.24E-15 | 2 | 47 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.5E-4 | 9 | 53 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MMDRKYGNGS RTNRAIEKGY WKTTGKDRPV AHDDRTMGMK KTLLYHAHVL TITDSHLCSL 60 IFVFLSLLEL ISPSITENHA PVLAA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang0032ss00820.4 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 1e-142 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014514424.1 | 2e-22 | NAC domain-containing protein 53 isoform X1 | ||||
| Refseq | XP_017409417.1 | 2e-22 | PREDICTED: NAC domain-containing protein 78-like | ||||
| Swissprot | Q84K00 | 9e-18 | NAC78_ARATH; NAC domain-containing protein 78 | ||||
| TrEMBL | A0A0L9TDV8 | 4e-21 | A0A0L9TDV8_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3SP57 | 5e-21 | A0A0S3SP57_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A1S3V8G1 | 4e-21 | A0A1S3V8G1_VIGRR; NAC domain-containing protein 53 isoform X1 | ||||
| STRING | XP_007144249.1 | 9e-21 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G04410.1 | 4e-20 | NAC domain containing protein 2 | ||||




