PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang0041ss00850.5

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NAC

Protein Properties

Length: 160aa MW: 18183.9 Da PI: 9.7021

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang0041ss00850.5	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.3	6.2e-53	7	131	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++PwdLp ++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ Vang0041ss00850.5 7 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWDLPGLASYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPI 97 79************************99.88***********7777799********************************* PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++vg+kk Lvfy g+apkg k++W+mheyrl Vang0041ss00850.5 98 GH--PKAVGIKKALVFYAGKAPKGDKSNWIMHEYRL 131 99..778*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.01E-58	3	134	IPR003441	NAC domain
PROSITE profile	PS51005	55.138	7	149	IPR003441	NAC domain
Pfam	PF02365	3.3E-28	8	131	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MASELQLPPG FRFHPTDEEL VMHYLCRKCA SQPIAVPIIA EIDLYKYDPW DLPGLASYGE 60 KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGHP KAVGIKKALV FYAGKAPKGD 120 KSNWIMHEYR LADVDRSVRK KNSLRVYAPY LHNPFPVQE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-70	3	131	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang0041ss00850.5

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ028770	0.0	DQ028770.1 Glycine max NAC domain protein NAC2 (NAC2) mRNA, complete cds.
GenBank	EU661909	0.0	EU661909.1 Glycine max NAC domain protein (NAC7) mRNA, partial cds.
GenBank	EU661911	0.0	EU661911.1 Glycine max NAC domain protein (NAC8) mRNA, complete cds.
GenBank	KT031211	0.0	KT031211.1 Glycine max clone HN_CCL_60 NAC transcription factor (Glyma06g11970.1) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014501798.1	1e-104	NAC domain-containing protein 2
Swissprot	Q39013	2e-94	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A1S3U6Y9	1e-103	A0A1S3U6Y9_VIGRR; NAC domain-containing protein 2
STRING	XP_007137423.1	1e-102	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	8e-97	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]