PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang0041ss00850.9

Common Name

LR48_Vigan04g176800

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NAC

Protein Properties

Length: 35aa MW: 3934.6 Da PI: 5.5649

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang0041ss00850.9	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	26.1	2.4e-08	2	32	17	48
NAM 17 eyLkkkvegkkleleevikevdiykvePwdLp 48 +yL++k++++++ + +i+e+d+yk++PwdLp Vang0041ss00850.9 2 HYLCRKCASQPIAV-PIIAEIDLYKYDPWDLP 32 8*********99.88************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.02E-9	1	33	IPR003441	NAC domain
PROSITE profile	PS51005	11.512	1	34	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 35 aa Download sequence Send to blast
MHYLCRKCAS QPIAVPIIAE IDLYKYDPWD LPGN*

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang0041ss00850.9

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	2e-51	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014501798.1	2e-16	NAC domain-containing protein 2
Refseq	XP_017422406.1	3e-16	PREDICTED: NAC domain-containing protein 2
Refseq	XP_018853577.1	2e-16	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	1e-15	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A2I4HBT5	4e-15	A0A2I4HBT5_JUGRE; NAC domain-containing protein 2-like
STRING	XP_008466736.1	1e-15	(Cucumis melo)
STRING	AES72289	1e-15	(Medicago truncatula)
STRING	XP_007137423.1	1e-15	(Phaseolus vulgaris)
STRING	XP_009795736.1	1e-15	(Nicotiana sylvestris)
STRING	XP_009625026.1	1e-15	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	4e-18	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]