![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang0063ss00900.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 102aa MW: 11709.1 Da PI: 10.0395 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 70.3 | 5e-22 | 9 | 73 | 53 | 118 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgek 118
+e++ewyfFs++d++y++g+r+n t +g+Wk+tg+dk+++s k+ +g++ktLvfyk++ap+g++
Vang0063ss00900.1 9 EEHNEWYFFSHKDNNYPRGTRTNTPTVAGFWKETGRDKAIYS-KHDSIGMRKTLVFYKAQAPNGQN 73
3567**************************************.8889****************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 20.155 | 1 | 101 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.09E-19 | 9 | 72 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.6E-9 | 13 | 70 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MESSRIGTEE HNEWYFFSHK DNNYPRGTRT NTPTVAGFWK ETGRDKAIYS KHDSIGMRKT 60 LVFYKAQAPN GQNQIGSCTS IDFKHTKMAH HRQVSQIITF I* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 7e-15 | 11 | 71 | 70 | 130 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 7e-15 | 11 | 71 | 70 | 130 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 7e-15 | 11 | 71 | 70 | 130 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 7e-15 | 11 | 71 | 70 | 130 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swm_B | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swm_C | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swm_D | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swp_A | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swp_B | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swp_C | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 3swp_D | 7e-15 | 11 | 71 | 73 | 133 | NAC domain-containing protein 19 |
| 4dul_A | 7e-15 | 11 | 71 | 70 | 130 | NAC domain-containing protein 19 |
| 4dul_B | 7e-15 | 11 | 71 | 70 | 130 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang0063ss00900.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 1e-163 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009773837.1 | 1e-35 | PREDICTED: NAC domain-containing protein 7-like | ||||
| Swissprot | O65508 | 3e-32 | NAC76_ARATH; NAC domain-containing protein 76 | ||||
| TrEMBL | A0A1U7W1C3 | 3e-34 | A0A1U7W1C3_NICSY; NAC domain-containing protein 7-like | ||||
| TrEMBL | A0A498JJ38 | 9e-35 | A0A498JJ38_MALDO; Uncharacterized protein | ||||
| TrEMBL | V4RL72 | 1e-34 | V4RL72_9ROSI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_009773837.1 | 5e-35 | (Nicotiana sylvestris) | ||||
| STRING | XP_006421693.1 | 2e-35 | (Citrus clementina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36160.1 | 1e-34 | NAC domain containing protein 76 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




