PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang0071ss00600.3

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB_related

Protein Properties

Length: 112aa MW: 12950.1 Da PI: 10.147

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang0071ss00600.3	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.5	9.7e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed++l ++++ +G g W+ +++ g++R++k+c++rw++yl Vang0071ss00600.3 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAGLKRCGKSCRLRWLNYL 61 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.3E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.316	9	65	IPR017930	Myb domain
SMART	SM00717	1.8E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.8E-22	15	90	IPR009057	Homeodomain-like
CDD	cd00167	2.71E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.6E-8	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGLKRCG KSCRLRWLNY 60 LRPGIKRGNI TNDEEELIIR LHNLLGNRYI YRHYSTCFSV FLLIITNFLS L*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-13	12	89	25	101	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang0071ss00600.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015042	1e-112	AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014515267.1	4e-58	myb-related protein 308-like
Refseq	XP_017405902.1	9e-59	PREDICTED: transcription factor MYB3-like
Refseq	XP_027337331.1	1e-58	transcription factor MYB8-like
Swissprot	P10290	2e-42	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A0L9T6S2	2e-57	A0A0L9T6S2_PHAAN; Uncharacterized protein
STRING	XP_007135450.1	2e-57	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16720.1	3e-43	myb domain protein 7

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]