![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang0114s00450.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 73aa MW: 8649.08 Da PI: 10.7531 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 54.4 | 3.4e-17 | 1 | 49 | 38 | 87 |
trihelix 38 mrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
mr+ g++r+ k+Ckekw+n+nk++kk+ke++k+r ++s+ cpyf+ql+a
Vang0114s00450.1 1 MRKLGYNRNTKRCKEKWDNINKYFKKVKESNKRR-LKDSKMCPYFNQLDA 49
8999****************************98.67788********85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF13837 | 2.0E-11 | 1 | 50 | No hit | No description |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MRKLGYNRNT KRCKEKWDNI NKYFKKVKES NKRRLKDSKM CPYFNQLDAL YREKSKVEGV 60 ATTVKLESTV GR* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang0114s00450.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015043 | 1e-119 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017415094.1 | 3e-33 | PREDICTED: trihelix transcription factor GT-2-like isoform X1 | ||||
| Refseq | XP_017415095.1 | 3e-33 | PREDICTED: trihelix transcription factor GT-2-like isoform X2 | ||||
| Swissprot | Q39117 | 4e-25 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
| TrEMBL | A0A0S3SND8 | 7e-32 | A0A0S3SND8_PHAAN; Uncharacterized protein | ||||
| STRING | XP_007143535.1 | 2e-30 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF373 | 34 | 181 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76880.1 | 4e-29 | Trihelix family protein | ||||




