![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang0143s00280.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 81aa MW: 9496.99 Da PI: 10.8354 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 88.5 | 7.4e-28 | 3 | 74 | 1 | 72 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72
+W++qe+laL+++r++m+ ++r+++ k+plWeevs+k+++ g++r++k+Ckek+en+ k++k++keg+k+++
Vang0143s00280.1 3 KWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLADLGYHRNAKKCKEKFENVYKYHKRTKEGRKDGR 74
7*******************************************************************9983 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 6.969 | 1 | 60 | IPR017877 | Myb-like domain |
| Pfam | PF13837 | 7.2E-18 | 2 | 74 | No hit | No description |
| CDD | cd12203 | 1.25E-20 | 2 | 67 | No hit | No description |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MKKWPRQETL ALLKIRSDMD VAFRDASVKG PLWEEVSRKL ADLGYHRNAK KCKEKFENVY 60 KYHKRTKEGR KDGRTSTRGK * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang0143s00280.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF372499 | 1e-82 | AF372499.1 Glycine max GT-2 factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007152027.1 | 4e-41 | hypothetical protein PHAVU_004G095400g | ||||
| Swissprot | Q39117 | 3e-32 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
| TrEMBL | Q8W239 | 2e-41 | Q8W239_SOYBN; GT-2 factor (Fragment) | ||||
| TrEMBL | V7C532 | 1e-39 | V7C532_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007152027.1 | 2e-40 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF21033 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76880.1 | 3e-39 | Trihelix family protein | ||||




