PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang01g08600.7

Common Name

LR48_Vigan07g106300

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

LBD

Protein Properties

Length: 89aa MW: 9952.62 Da PI: 8.2168

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang01g08600.7	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	80.8	2.2e-25	1	70	32	101
DUF260 32 nvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 +vhk+FG +n++k+l+++p e+red+++slvyeA+ar+r+PvyG+vg+i++l+ q+++l+++la++++e+ Vang01g08600.7 1 MVHKVFGCKNLTKMLQDVPVEKREDIVKSLVYEANARVRNPVYGCVGLISNLEIQVSELQTQLAVAQAEI 70 59***************************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	15.274	1	70	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	3.0E-24	2	67	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MVHKVFGCKN LTKMLQDVPV EKREDIVKSL VYEANARVRN PVYGCVGLIS NLEIQVSELQ 60 TQLAVAQAEI LTMKMQQEFT FNNGRISP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	5e-23	2	71	43	112	LOB family transfactor Ramosa2.1
5ly0_B	5e-23	2	71	43	112	LOB family transfactor Ramosa2.1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang01g08600.7

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015036	1e-121	AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017428642.1	6e-59	PREDICTED: LOB domain-containing protein 12-like
Swissprot	Q8LBW3	2e-32	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	A0A0L9UXT4	1e-57	A0A0L9UXT4_PHAAN; Uncharacterized protein
STRING	XP_007142160.1	8e-42	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	7e-35	LBD family protein

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715] Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024]