PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang01g08600.9

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

LBD

Protein Properties

Length: 66aa MW: 7923.43 Da PI: 10.0234

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang01g08600.9	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	51.9	2.2e-16	1	41	8	48
DUF260 8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48 lrr+C+++C++apyfp ++ +kfa+vhk+FG +n++k+l+ Vang01g08600.9 1 LRRRCSQNCIFAPYFPPNDLHKFAMVHKVFGCKNLTKMLQV 41 69************************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03195	4.7E-15	1	41	IPR004883	Lateral organ boundaries, LOB
PROSITE profile	PS50891	13.215	1	65	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
LRRRCSQNCI FAPYFPPNDL HKFAMVHKVF GCKNLTKMLQ VFMYNIYTSI FQKCNRADFI 60 YQMYK*

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang01g08600.9

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015036	1e-106	AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017428642.1	3e-23	PREDICTED: LOB domain-containing protein 12-like
Swissprot	Q8LBW3	3e-17	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	A0A0L9UXT4	6e-22	A0A0L9UXT4_PHAAN; Uncharacterized protein
STRING	GRMZM2G025989_P01	9e-17	(Zea mays)
STRING	XP_010045372.1	5e-17	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	1e-19	LBD family protein

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715]