PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang01g11450.2

Common Name

LR48_Vigan01g103500

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NAC

Protein Properties

Length: 74aa MW: 8643.64 Da PI: 4.6918

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang01g11450.2	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	58.7	2e-18	25	70	3	49
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 pGfrFhPtde+lv++yL++k+++k++++ + i+++diyk++PwdLp+ Vang01g11450.2 25 PGFRFHPTDEDLVSFYLQRKLHKKPISI-DLINQIDIYKYDPWDLPS 70 9*************************.99************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.23E-18	23	71	IPR003441	NAC domain
PROSITE profile	PS51005	19.921	23	73	IPR003441	NAC domain
Pfam	PF02365	9.2E-8	25	66	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MGVNENFNNN HDHHGCVDDD EIPLPGFRFH PTDEDLVSFY LQRKLHKKPI SIDLINQIDI 60 YKYDPWDLPS MFS*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang01g11450.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	1e-121	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
GenBank	AP015036	1e-121	AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007149303.1	5e-37	hypothetical protein PHAVU_005G059000g
Swissprot	Q9SK55	6e-21	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A0L9TLR4	3e-46	A0A0L9TLR4_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3R143	8e-46	A0A0S3R143_PHAAN; Uncharacterized protein
STRING	XP_007149303.1	2e-36	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	2e-23	NAC domain containing protein 42

Publications ? help Back to Top
Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]