PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang01g19410.4

Common Name

LR48_Vigan01g330800

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB_related

Protein Properties

Length: 137aa MW: 15237.3 Da PI: 11.3169

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang01g19410.4	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51	3.4e-16	30	70	3	45
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++Tt Ed ++++a+ +lG++ W++Iar ++ gRt++ +k++w+ Vang01g19410.4 30 PFTTREDAIILHAHDRLGNK-WAAIARLLP-GRTDNAVKNHWN 70 89****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.476	1	22	IPR017930	Myb domain
SuperFamily	SSF46689	2.33E-24	2	77	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.2E-10	2	35	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.956	23	77	IPR017930	Myb domain
SMART	SM00717	5.5E-13	27	75	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-13	30	70	IPR001005	SANT/Myb domain
CDD	cd00167	3.38E-10	30	73	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.2E-18	36	74	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
LISLHVKGRS GKSCRLRWCN QLSPTVEHRP FTTREDAIIL HAHDRLGNKW AAIARLLPGR 60 TDNAVKNHWN ATLKRRASQR RRFGDDPLTA LTLAPPGSGG GGWTGGFRDV VAREVREYVS 120 FSFSDKLGSN EKLSKY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-29	1	78	32	109	B-MYB
1gv2_A	3e-29	1	77	29	105	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang01g19410.4

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015036	0.0	AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017433979.1	8e-97	PREDICTED: transcription factor MYB44-like
Swissprot	O23160	9e-35	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A0L9TTL0	2e-95	A0A0L9TTL0_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3RQ43	2e-95	A0A0S3RQ43_PHAAN; Uncharacterized protein
STRING	GLYMA17G36370.2	5e-65	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G23290.1	2e-37	myb domain protein 70

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024]